Liraglutide — illustrative photo of a kit of 10 vials — Illustrative packaging. Supplied materials and packaging vary by order.

Metabolic research · Research proteins & analogues

Liraglutide

Liraglutide: a GLP-1 receptor agonist with a C16 fatty-acid side chain, for incretin and metabolic research; white to off-white lyophilized powder in 5 mg, 10 mg, 20 mg and 30 mg vials.

Every lot ships with its COA — HPLC purity + MS identity
Purity specification ≥ 99.0%
From 1 kit (10 vials) per SKU
Written quote by email or WhatsApp

Specification

$195.50 / kit of 10 vials

$19.55 per vial · line total $195.50

kit · 10 vials

Need another spec, a larger fill or custom labelling?

Reference prices · Liraglutide 10 mg
Kits on your quote list	Price / kit
Retail · 1–4 kits	$195.50
Wholesale · 5–19 kits (−20%)	$156.40
20+ kits	Ask for a quote

Kits count across your whole quote list, so different products add up. Pricing FAQ

Reference prices in USD, per kit of 10 vials. The final price is the one on your written quote. Need another currency? Your sales representative can quote it.

Specifications

Liraglutide parameters

CAS number	204656-20-2
Molecular formula	C172H265N43O51
Molecular weight	3751.2 g/mol
Sequence	HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
PubChem CID	16134956
Purity specification	≥ 99.0% (HPLC)
Appearance	White to off-white lyophilized powder
Specifications	5 mg, 10 mg, 20 mg, 30 mg
Kit	10 vials per kit · minimum 1 kit per SKU
Storage	Storage follows the label, COA and stability data of your lot. The 2–8 °C instructions printed for the approved pen medicines were written for those finished products; they do not set the storage of a lyophilized research powder or of a solution made from it.

Specifications and reference prices
SKU	Content	Price / kit	Per vial
`LIRA5`	5 mg	On request	—
`LIRA10`	10 mg	$195.50	$19.55
`LIRA20`	20 mg	On request	—
`LIRA30`	30 mg	On request	—

Another format

Liraglutide in a nasal spray bottle

Strengths: 5 mg
Fill: 10 mL or 20 mL
At least: 10 bottles of one strength and size
Dispatched from: US stock, to US addresses

Nasal sprays are quoted by our sales team, separately from the kits on your quote list.

Black 10 mL nasal spray bottle with a clear dust cap — Spray bottle, 10 mL

Test results for every lot

Each lot of Liraglutide has its own certificate of analysis with HPLC purity and mass-spectrometry (MS) identity. Other tests — water content, counter-ion, endotoxin — are available on request and listed on the COA when tested.

Batch COAs 3

Batch COA, lot release

Liraglutide

5 mg

HPLC purity · MS identity

Batch COA, lot release

Liraglutide

10 mg

HPLC purity · MS identity

Batch COA, lot release

Liraglutide

30 mg

HPLC purity · MS identity

Previews show the first page only, at a resolution where small print cannot be read; numbers, dates, names and signatures are covered. The full, clear copy comes from our sales team.

COA of the batch you receive: ask our sales team.

Independent test fails? Full refund. How the refund works

How to read a COA →

Research background

About Liraglutide

Liraglutide is a 31-residue analogue of human GLP-1; its sequence is in the table above. Two changes separate it from the native hormone: an Arg34 substitution, and a palmitic (C16) acid attached to Lys26 through a γ-glutamic acid spacer. The fatty acid binds albumin, which gives the molecule a much longer circulating half-life than GLP-1 itself. Knudsen and Lau (2019) trace how this design was worked out and then carried forward to Semaglutide.

We list Liraglutide under Metabolic research with the other incretin analogues. The same molecule is the active ingredient of approved medicines, so most of its literature is clinical — for example the LEAD-6 comparison with exenatide in type 2 diabetes (Buse et al., 2009) and a cardiovascular-outcome trial in type 2 diabetes (Marso et al., 2016). What we supply is lyophilized research material with a COA for every lot, not a medicine.

Selected literature

For laboratory research use. This page describes published research and the material we supply; it is not medical advice.

Liraglutide FAQ

How does Liraglutide differ from Semaglutide?

Both are lipidated GLP-1 analogues that came out of the same line of design work (Knudsen and Lau, 2019). Liraglutide carries a C16 fatty acid on a single γ-glutamic acid spacer; Semaglutide carries a longer C18 fatty diacid on an extended linker and has one more substitution in its peptide chain. They are separate products, each with its own COA per lot.

Does the sequence in the table include the fatty-acid chain?

No. The one-letter sequence lists the 31 amino acids of the peptide chain only. The C16 side chain on Lys26 is part of the molecule and is counted in the formula and molecular weight (C172H265N43O51, 3751.2 g/mol), so use those values for molar calculations.

How to order

Ordering Liraglutide from Medabol

Kit and minimum: Liraglutide is sold by the kit: 10 vials of one specification (5 mg, 10 mg, 20 mg and 30 mg). The minimum is 1 kit per SKU, so an individual buyer can order a single kit and a lab can order many.
Price: Reference prices are listed per kit above, from $195.50. The kits of your whole quote list count together — 5–19 kits are 20% off every kit, and from 20 kits our sales team quotes the price — so Liraglutide adds up with anything else you order; your written quote has the final price.
Documents: Every lot has its own COA with HPLC purity and MS identity; the order ships with the certificate of its lot, and our sales team sends it before you order if you ask.
Shipping: Orders ship from China by international express courier. Shipping from $80 per order; the written quote confirms the exact charge for your destination.
Payment: Nothing is paid on this website. After you send your quote list, a sales representative confirms the amount and shipping on WhatsApp or by email and tells you in that chat how to pay.
Research goal: Listed under Metabolic research — Incretin and amylin analogues and energy-balance compounds.

Questions first?

Ask about Liraglutide.

Quantities, documents, timing or a spec that is not listed — the reply comes from a sales representative.

Name *

Email *

WhatsApp / Phone

Required for Chat on WhatsApp.

Message *

Liraglutide

Liraglutide parameters

Liraglutide in a nasal spray bottle

Test results for every lot

Batch COAs 3

Liraglutide

Liraglutide

Liraglutide

About Liraglutide

Selected literature

Liraglutide FAQ

Ordering Liraglutide from Medabol

Ask about Liraglutide.

More in research proteins & analogues.

Cerebrolysin

Dulaglutide

EPO

HMG