EPO — illustrative photo of a kit of 10 vials — Illustrative packaging. Supplied materials and packaging vary by order.

EPO 3000 IU — illustrative photo of an unlabelled vial of a clear liquid — Illustrative packaging. Supplied materials and packaging vary by order.

Hormone & growth axis · Research proteins & analogues

EPO

EPO (erythropoietin): the recombinant 165-residue glycoprotein hormone that drives red-cell production, as a clear, colourless liquid in a 3000 IU specification.

Every lot ships with its COA — HPLC purity + MS identity
Purity specification ≥ 95% (SEC/RP-HPLC)
From 1 kit (10 vials) per SKU
Written quote by email or WhatsApp

Specification

$97.75 / kit of 10 vials

$9.78 per vial · line total $97.75

kit · 10 vials

Need another spec, a larger fill or custom labelling?

Reference prices · EPO 3000 IU
Kits on your quote list	Price / kit
Retail · 1–4 kits	$97.75
Wholesale · 5–19 kits (−20%)	$78.20
20+ kits	Ask for a quote

Kits count across your whole quote list, so different products add up. Pricing FAQ

Reference prices in USD, per kit of 10 vials. The final price is the one on your written quote. Need another currency? Your sales representative can quote it.

Specifications

EPO parameters

CAS number	11096-26-7
Molecular formula	C809H1301N229O240S5
Molecular weight	18235.7 g/mol
Sequence	APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD
Purity specification	≥ 95% (SEC/RP-HPLC) (HPLC)
Appearance	Clear, colorless liquid
Specifications	3000 IU
Kit	10 vials per kit · minimum 1 kit per SKU
Storage	Storage follows the COA and manufacturer stability instructions of your lot. Avoid freezing, shaking and unchecked temperature excursions where the documents say so; exact requirements depend on the formulation and container.

Specifications and reference prices
SKU	Content	Price / kit	Per vial
`EPO3000`	3000 IU	$97.75	$9.78

Test results for every lot

Each lot of EPO has its own certificate of analysis with HPLC purity and mass-spectrometry (MS) identity. Other tests — water content, counter-ion, endotoxin — are available on request and listed on the COA when tested.

Batch COAs 1

EPO 3000 IU batch coa: first page, low-resolution preview

Batch COA, lot release

EPO

3000 IU

Isoform identity · Bioassay

Previews show the first page only, at a resolution where small print cannot be read; numbers, dates, names and signatures are covered. The full, clear copy comes from our sales team.

COA of the batch you receive: ask our sales team.

Independent test fails? Full refund. How the refund works

How to read a COA →

Research background

About EPO

Erythropoietin is the glycoprotein hormone that controls red-blood-cell production, made in the body mainly by kidney cells. It acts through the EPO receptor on erythroid progenitor cells; Watowich (2011) reviews the receptor's structure and signalling. The protein chain has 165 residues, and its sugar chains shape how it behaves.

Because glycosylation varies between products, the activity of EPO is given in international units — the specification here is 3000 IU — and its purity is specified at ≥95% by SEC/RP-HPLC. EPO is listed under Hormone & growth axis; the EPO-derived peptide ARA 290 is in Recovery & repair.

Selected literature

Watowich SS. J Investig Med. 2011;59(7):1067-1072.

For laboratory research use. This page describes published research and the material we supply; it is not medical advice.

EPO FAQ

Is this EPO a peptide or a protein?

A recombinant glycoprotein: 165 amino acids with attached sugar chains, and a molecular weight of 18235.7 g/mol for the protein formula in the table. It is supplied as a liquid, not a powder.

Can I get extra tests on an EPO lot?

The COA reports HPLC purity and MS identity. Other tests are available on request and listed on the COA when tested — say in your inquiry which ones your work needs.

How to order

Ordering EPO from Medabol

Kit and minimum: EPO is sold by the kit: 10 vials of one specification (3000 IU). The minimum is 1 kit per SKU, so an individual buyer can order a single kit and a lab can order many.
Price: Reference prices are listed per kit above, from $97.75. The kits of your whole quote list count together — 5–19 kits are 20% off every kit, and from 20 kits our sales team quotes the price — so EPO adds up with anything else you order; your written quote has the final price.
Documents: Every lot has its own COA with HPLC purity and MS identity; the order ships with the certificate of its lot, and our sales team sends it before you order if you ask.
Shipping: Orders ship from China by international express courier. Shipping from $80 per order; the written quote confirms the exact charge for your destination.
Payment: Nothing is paid on this website. After you send your quote list, a sales representative confirms the amount and shipping on WhatsApp or by email and tells you in that chat how to pay.
Research goal: Listed under Hormone & growth axis — GH secretagogues, GHRH analogues, IGF-1 variants and reproductive-axis peptides.

Questions first?

Ask about EPO.

Quantities, documents, timing or a spec that is not listed — the reply comes from a sales representative.

Name *

Email *

WhatsApp / Phone

Required for Chat on WhatsApp.

Message *

EPO

EPO parameters

Test results for every lot

Batch COAs 1

EPO

About EPO

Selected literature

EPO FAQ

Ordering EPO from Medabol

Ask about EPO.

More in research proteins & analogues.

Cerebrolysin

Dulaglutide

HMG

Liraglutide