ACTH 1-39 — illustrative photo of a kit of 10 vials — Illustrative packaging. Supplied materials and packaging vary by order.

Hormone & growth axis · Research peptides

ACTH 1-39

ACTH 1-39 is listed as a research peptides material for qualified research and analytical procurement workflows.

Every lot ships with its COA — HPLC purity + MS identity
Purity specification ≥ 98%
From 1 kit (10 vials) per SKU
Written quote by email or WhatsApp

This entry is on the controlled SKU list; the first reply confirms its technical scope before procurement.

Specification

$88.55 / kit of 10 vials

$8.86 per vial · line total $88.55

kit · 10 vials

Need another spec, a larger fill or custom labelling?

Reference prices · ACTH 1-39 5 mg
Kits on your quote list	Price / kit
Retail · 1–4 kits	$88.55
Wholesale · 5–19 kits (−20%)	$70.84
20+ kits	Ask for a quote

Kits count across your whole quote list, so different products add up. Pricing FAQ

Reference prices in USD, per kit of 10 vials. The final price is the one on your written quote. Need another currency? Your sales representative can quote it.

Specifications

ACTH 1-39 parameters

CAS number	12279-41-3
Molecular formula	C207H308N56O58S
Molecular weight	4541 g/mol
Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
PubChem CID	16132265
Purity specification	≥ 98% (HPLC)
Appearance	White to off-white lyophilized powder
Specifications	5 mg
Kit	10 vials per kit · minimum 1 kit per SKU
Storage	Storage and handling requirements are configuration- and lot-specific; request the applicable documentation before ordering.

Specifications and reference prices
SKU	Content	Price / kit	Per vial
`ACTH5`	5 mg	$88.55	$8.86

Test results for every lot

Each lot of ACTH 1-39 has its own certificate of analysis with HPLC purity and mass-spectrometry (MS) identity. Other tests — water content, counter-ion, endotoxin — are available on request and listed on the COA when tested.

Batch COAs 1

Batch COA, lot release

ACTH 1-39

5 mg

HPLC purity · MS identity

Previews show the first page only, at a resolution where small print cannot be read; numbers, dates, names and signatures are covered. The full, clear copy comes from our sales team.

COA of the batch you receive: ask our sales team.

Independent test fails? Full refund. How the refund works

How to read a COA →

Research background

About ACTH 1-39

The full-length 39-amino-acid corticotropin peptide, connected with HPA-axis (stress-hormone) biology and melanocortin receptors (MC2R).

This catalog entry is sourced from the reviewed SKU workbook. Available specifications, pack quantities, SKU identifiers, and prices are kept aligned with that source; lot-specific analytical documentation is available with the corresponding batch. Supplied strictly for laboratory research use.

Selected literature

Ghaddhab C, Vuissoz JM, Deladoëy J. From Bioinactive ACTH to ACTH Antagonist: The Clinical Perspective. Front Endocrinol (Lausanne). 2017;8:17.
Chen M, Aprahamian CJ, Kesterson RA Jr, Harmon CM, Yang Y. Molecular identification of melanocortin-2 receptor responsible for ligand binding and signaling. Biochemistry. 2007;46(40):11389-11397.
Chakraborty R, Mehta A, Nair N, Nemer L, Jain R, Joshi H, Raina R. ACTH Treatment for Management of Nephrotic Syndrome: A Systematic Review and Reappraisal. Int J Nephrol. 2020;2020:2597079.
Hladunewich MA, Cattran D, Beck LH, et al. A pilot study to determine the dose and effectiveness of adrenocorticotrophic hormone (H.P. Acthar Gel) in nephrotic syndrome due to idiopathic membranous nephropathy. Nephrol Dial Transplant. 2014;29(8):1570-1577.
Duchowny MS, Chopra I, Niewoehner J, Wan GJ, Devine B. A Systematic Literature Review and Indirect Treatment Comparison of Efficacy of Repository Corticotropin Injection versus Synthetic Adrenocorticotropic Hormone for Infantile Spasms. J Health Econ Outcomes Res. 2021;8(1):1-9.

For laboratory research use. This page describes published research and the material we supply; it is not medical advice.

How to order

Ordering ACTH 1-39 from Medabol

Kit and minimum: ACTH 1-39 is sold by the kit: 10 vials of one specification (5 mg). The minimum is 1 kit per SKU, so an individual buyer can order a single kit and a lab can order many.
Price: Reference prices are listed per kit above, from $88.55. The kits of your whole quote list count together — 5–19 kits are 20% off every kit, and from 20 kits our sales team quotes the price — so ACTH 1-39 adds up with anything else you order; your written quote has the final price.
Documents: Every lot has its own COA with HPLC purity and MS identity; the order ships with the certificate of its lot, and our sales team sends it before you order if you ask.
Shipping: Orders ship from China by international express courier. Shipping from $80 per order; the written quote confirms the exact charge for your destination.
Payment: Nothing is paid on this website. After you send your quote list, a sales representative confirms the amount and shipping on WhatsApp or by email and tells you in that chat how to pay.
Research goal: Listed under Hormone & growth axis — GH secretagogues, GHRH analogues, IGF-1 variants and reproductive-axis peptides.

Questions first?

Ask about ACTH 1-39.

Quantities, documents, timing or a spec that is not listed — the reply comes from a sales representative.

Name *

Email *

WhatsApp / Phone

Required for Chat on WhatsApp.

Message *

ACTH 1-39

ACTH 1-39 parameters

Test results for every lot

Batch COAs 1

ACTH 1-39

About ACTH 1-39

Selected literature

Ordering ACTH 1-39 from Medabol

Ask about ACTH 1-39.

More in research peptides.

5-Amino-1MQ

ACE-031

Adamax

Adipotide / FTPP