LL-37

LL-37: the 37-residue human cathelicidin peptide, studied in host-defence and innate-immunity research; lyophilized powder.

Every lot ships with its COA — HPLC purity + MS identity
Purity specification ≥ 99.0%
From 1 kit (10 vials) per SKU
Written quote by email or WhatsApp

Specification

$118.45 / kit of 10 vials

$11.85 per vial · line total $118.45

kit · 10 vials

Need another spec, a larger fill or custom labelling?

Reference prices · LL-37 5 mg
Kits on your quote list	Price / kit
Retail · 1–4 kits	$118.45
Wholesale · 5–19 kits (−20%)	$94.76
20+ kits	Ask for a quote

Kits count across your whole quote list, so different products add up. Pricing FAQ

Reference prices in USD, per kit of 10 vials. The final price is the one on your written quote. Need another currency? Your sales representative can quote it.

Specifications

LL-37 parameters

CAS number	154947-66-7
Molecular formula	C205H340N60O53
Molecular weight	4493.3 g/mol
Sequence	[LL-37, 37 aa]
PubChem CID	16198951
Purity specification	≥ 99.0% (HPLC)
Appearance	White to off-white lyophilized powder
Specifications	5 mg
Kit	10 vials per kit · minimum 1 kit per SKU
Storage	Keep the dry powder away from moisture, light and unsuitable temperatures, as the label and COA of your lot state. In solution LL-37 can stick to surfaces, oxidize or be cut by proteases, so check recovery in your own setup instead of assuming a standard refrigerated hold time.

Specifications and reference prices
SKU	Content	Price / kit	Per vial
`LL5`	5 mg	$118.45	$11.85

Another format

LL-37 in a nasal spray bottle

Strengths: 5 mg · 10 mg
Fill: 10 mL or 20 mL
At least: 10 bottles of one strength and size
Dispatched from: US stock, to US addresses

Nasal sprays are quoted by our sales team, separately from the kits on your quote list.

Black 10 mL nasal spray bottle with a clear dust cap — Spray bottle, 10 mL

Test results for every lot

Each lot of LL-37 has its own certificate of analysis with HPLC purity and mass-spectrometry (MS) identity. Other tests — water content, counter-ion, endotoxin — are available on request and listed on the COA when tested.

Batch COAs 1

Batch COA, lot release

LL-37

5 mg

HPLC purity · MS identity

Previews show the first page only, at a resolution where small print cannot be read; numbers, dates, names and signatures are covered. The full, clear copy comes from our sales team.

COA of the batch you receive: ask our sales team.

Independent test fails? Full refund. How the refund works

How to read a COA →

Research background

About LL-37

LL-37 is the only cathelicidin peptide made by humans. It is cut from a larger precursor protein, hCAP-18, and is named after its first two residues (two leucines) and its length of 37 amino acids. The chain carries many positive charges and folds into a helix next to membranes.

Research on LL-37 covers its direct action on microbes and its signalling role in innate immunity. The precursor was first described under the name FALL-39, expressed in bone marrow (Agerberth et al., 1995), then found in the epithelium of the airways (Bals et al., 1998); a 2006 review by Dürr and colleagues covers its structure and membrane activity. It sits in our Recovery & repair group with KPV and Thymosin Alpha 1.

Selected literature

For laboratory research use. This page describes published research and the material we supply; it is not medical advice.

LL-37 FAQ

Why can measured LL-37 come out lower than the weighed amount?

Because the peptide is strongly cationic, it binds to plastic and glass at low concentrations. Many labs make dilutions in low-binding tubes. The COA covers the lot's HPLC purity and MS identity; recovery in your own buffer is worth checking in your setup.

Can I get an endotoxin result for LL-37?

Yes, on request. Endotoxin and other extra tests are listed on the COA when they are run, so mention it in the message with your quote list if your work needs it.

How to order

Ordering LL-37 from Medabol

Kit and minimum: LL-37 is sold by the kit: 10 vials of one specification (5 mg). The minimum is 1 kit per SKU, so an individual buyer can order a single kit and a lab can order many.
Price: Reference prices are listed per kit above, from $118.45. The kits of your whole quote list count together — 5–19 kits are 20% off every kit, and from 20 kits our sales team quotes the price — so LL-37 adds up with anything else you order; your written quote has the final price.
Documents: Every lot has its own COA with HPLC purity and MS identity; the order ships with the certificate of its lot, and our sales team sends it before you order if you ask.
Shipping: Orders ship from China by international express courier. Shipping from $80 per order; the written quote confirms the exact charge for your destination.
Payment: Nothing is paid on this website. After you send your quote list, a sales representative confirms the amount and shipping on WhatsApp or by email and tells you in that chat how to pay.
Research goal: Listed under Recovery & repair — BPC-157, TB-500, their blends and immune-signalling peptides.

Questions first?

Ask about LL-37.

Quantities, documents, timing or a spec that is not listed — the reply comes from a sales representative.

Name *

Email *

WhatsApp / Phone

Required for Chat on WhatsApp.

Message *

LL-37

LL-37 parameters

LL-37 in a nasal spray bottle

Test results for every lot

Batch COAs 1

LL-37

About LL-37

Selected literature

LL-37 FAQ

Ordering LL-37 from Medabol

Ask about LL-37.

More in research peptides.

5-Amino-1MQ

ACE-031

ACTH 1-39

Adamax