FOXO4-DRI — illustrative photo of a kit of 10 vials — Illustrative packaging. Supplied materials and packaging vary by order.

Longevity & mitochondria · Research peptides

FOXO4-DRI

FOXO4-DRI: a 46-residue D-retro-inverso peptide aimed at the FOXO4–p53 interaction, studied in cell and mouse models of cellular senescence; lyophilized powder.

Every lot ships with its COA — HPLC purity + MS identity
Purity specification ≥ 99.0%
From 1 kit (10 vials) per SKU
Written quote by email or WhatsApp

Specification

$652.05 / kit of 10 vials

$65.21 per vial · line total $652.05

kit · 10 vials

Need another spec, a larger fill or custom labelling?

Reference prices · FOXO4-DRI 10 mg
Kits on your quote list	Price / kit
Retail · 1–4 kits	$652.05
Wholesale · 5–19 kits (−20%)	$521.64
20+ kits	Ask for a quote

Kits count across your whole quote list, so different products add up. Pricing FAQ

Reference prices in USD, per kit of 10 vials. The final price is the one on your written quote. Need another currency? Your sales representative can quote it.

Specifications

FOXO4-DRI parameters

CAS number	2460055-10-9
Molecular formula	C228H388N86O64
Molecular weight	5358 g/mol
Sequence	LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG
PubChem CID	167312269
Purity specification	≥ 99.0% (HPLC)
Appearance	White to off-white lyophilized powder
Specifications	2 mg, 10 mg
Kit	10 vials per kit · minimum 1 kit per SKU
Storage	Storage follows the COA and safety data sheet of your lot; no temperature, light protection or solution hold time is stated here for this form. Avoid freeze–thaw cycles that have not been checked for it.

Specifications and reference prices
SKU	Content	Price / kit	Per vial
`FOXO42`	2 mg	On request	—
`FOXO410`	10 mg	$652.05	$65.21

Another format

FOXO4-DRI in a nasal spray bottle

Strengths: 2 mg
Fill: 10 mL or 20 mL
At least: 10 bottles of one strength and size
Dispatched from: US stock, to US addresses

Nasal sprays are quoted by our sales team, separately from the kits on your quote list.

Black 10 mL nasal spray bottle with a clear dust cap — Spray bottle, 10 mL

Test results for every lot

Each lot of FOXO4-DRI has its own certificate of analysis with HPLC purity and mass-spectrometry (MS) identity. Other tests — water content, counter-ion, endotoxin — are available on request and listed on the COA when tested.

Batch COAs 2

Batch COA, lot release

FOXO4-DRI

2 mg

HPLC purity · MS identity

Batch COA, lot release

FOXO4-DRI

10 mg

HPLC purity · MS identity

Previews show the first page only, at a resolution where small print cannot be read; numbers, dates, names and signatures are covered. The full, clear copy comes from our sales team.

COA of the batch you receive: ask our sales team.

Independent test fails? Full refund. How the refund works

How to read a COA →

Research background

About FOXO4-DRI

FOXO4-DRI is made of D-amino acids assembled in reverse order — the "retro-inverso" design — which keeps the shape of the binding surface while making the chain hard for proteases to cut. Its 46 residues combine a FOXO4-derived segment that interferes with the binding of FOXO4 to p53 and a cell-penetrating segment.

The peptide became widely known through the 2017 paper in Cell by Baar and colleagues in the de Keizer group, which used it to trigger apoptosis of senescent cells in mice. Later work applied it to senescent human chondrocytes grown in culture (Huang et al., 2021) and to fibrosis models in mice (Han et al., 2022). The evidence comes from cells and animals only. We list FOXO4-DRI under Longevity & mitochondria with the other senescence-research peptides.

Selected literature

For laboratory research use. This page describes published research and the material we supply; it is not medical advice.

FOXO4-DRI FAQ

Is FOXO4-DRI the same as a FOXO4 fragment made of ordinary amino acids?

No. Its sequence runs in reverse and is built from D-amino acids, so an L-peptide with the same letters is a different compound. Compare the name and the molecular weight on the COA of your lot (5358 g/mol) with the table above.

What else is in the same group?

Longevity & mitochondria also lists Epithalon, the bioregulator peptides and the mitochondrial peptides such as SS-31 and Humanin. Kits from any group go on one quote list.

How to order

Ordering FOXO4-DRI from Medabol

Kit and minimum: FOXO4-DRI is sold by the kit: 10 vials of one specification (2 mg and 10 mg). The minimum is 1 kit per SKU, so an individual buyer can order a single kit and a lab can order many.
Price: Reference prices are listed per kit above, from $652.05. The kits of your whole quote list count together — 5–19 kits are 20% off every kit, and from 20 kits our sales team quotes the price — so FOXO4-DRI adds up with anything else you order; your written quote has the final price.
Documents: Every lot has its own COA with HPLC purity and MS identity; the order ships with the certificate of its lot, and our sales team sends it before you order if you ask.
Shipping: Orders ship from China by international express courier. Shipping from $80 per order; the written quote confirms the exact charge for your destination.
Payment: Nothing is paid on this website. After you send your quote list, a sales representative confirms the amount and shipping on WhatsApp or by email and tells you in that chat how to pay.
Research goal: Listed under Longevity & mitochondria — Mitochondrial peptides, NAD+ and cofactors, and bioregulator peptides.

Questions first?

Ask about FOXO4-DRI.

Quantities, documents, timing or a spec that is not listed — the reply comes from a sales representative.

Name *

Email *

WhatsApp / Phone

Required for Chat on WhatsApp.

Message *

FOXO4-DRI

FOXO4-DRI parameters

FOXO4-DRI in a nasal spray bottle

Test results for every lot

Batch COAs 2

FOXO4-DRI

FOXO4-DRI

About FOXO4-DRI

Selected literature

FOXO4-DRI FAQ

Ordering FOXO4-DRI from Medabol

Ask about FOXO4-DRI.

More in research peptides.

5-Amino-1MQ

ACE-031

ACTH 1-39

Adamax